Everything below concerns G protein-coupled receptor. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-09-25. Numbers and descriptions here follow the published literature rather than marketing material.
Bremelanotide is a cyclic heptapeptide that binds several melanocortin receptors rather than one. In vitro assays report agonist activity at MC1R, MC3R, MC4R and MC5R, with MC4R generally treated as the subtype most relevant to sexual effects. MC4R is expressed in hypothalamic nuclei involved in appetite, energy balance and motivated behaviour, which provides a plausible route for central action. Selective MC4R agonists studied in animals produce comparable behavioural changes, supporting that interpretation.
How receptor activation translates into a change in desire is not established in detail. Proposed steps include modulation of dopaminergic signalling in reward circuits and downstream effects on autonomic tone. Human data consist mainly of clinical trials measuring self-reported outcomes rather than direct measurements of brain activity or transmitter release. The transient rise in blood pressure sometimes observed after administration is likewise reported consistently but explained only partly by known melanocortin pathways.
Melanocortin receptors form a family of five G-protein-coupled proteins, labelled MC1R through MC5R, that respond to peptides derived from pro-opiomelanocortin. Alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone are the best-known endogenous ligands. The receptors are distributed differently across tissues, so a single agonist can produce effects in the brain, skin, adrenal gland and vasculature. This distribution explains why one peptide can influence both pigmentation and motivated behaviour.
From a pharmacokinetic standpoint, the peptide is usually delivered by injection because oral bioavailability is very low; proteases in the digestive tract degrade it rapidly. After subcutaneous administration, plasma concentrations reach a peak within roughly one hour. Its elimination half-life is relatively short, with most reports placing it in the range of a few hours. Nasal formulations have also been examined, though absorption varies widely between individuals. Metabolism proceeds mainly through peptidase cleavage, and the resulting products are excreted by the kidneys.
PT-141 initiates cellular signaling by binding to specific subtypes within the melanocortin receptor family. These receptors belong to the G protein-coupled receptor superfamily, and activation raises intracellular cyclic adenosine monophosphate levels. This cascade ultimately influences neuronal circuits in the central nervous system that are associated with sexual desire and arousal. Research indicates the compound's action concentrates in hypothalamic regions rather than peripheral tissues, which helps explain some observed pharmacological features. The selectivity of receptor binding underlies its functional differences.
| Property | Value | Notes |
|---|---|---|
| Primary receptor target | MC4R agonist | Subtype most often linked to behavioural effects |
| Other reported targets | MC1R, MC3R, MC5R | Activity is not selective for a single subtype |
| Endogenous ligand class | Melanocortin peptides | Alpha-MSH and ACTH act on the same family |
| Peptide architecture | Cyclic heptapeptide | Lactam bridge between the aspartate and lysine residues |
| Central action | Inferred from animal models | Not directly measured in the human brain |
The compound emerged from a research programme examining melanocortin analogues for effects on skin pigmentation. During early human studies, participants reported spontaneous erections as an unexpected side effect, which redirected development toward sexual function rather than tanning. An intranasal formulation was investigated in clinical trials but did not reach market approval. A subcutaneous injectable version later completed the regulatory process, and the nasal route does not appear in approved labelling.
Approved use is narrow and jurisdiction-specific. In the United States, the injectable product is authorised for premenopausal women with acquired, generalised hypoactive sexual desire disorder, a diagnosis that requires documented distress. It is not approved for men, for postmenopausal women, or for use alongside hormonal contraceptives under the approved labelling. Outside regulated markets, the same peptide is frequently sold as a research chemical, where identity, purity, and sterility are not independently verified.
Pathology Laboratory Clinical Biology Laboratory Virology Laboratory Parasitology Laboratory Clinical Microbiology Laboratory Immunology Unit Data Center Administration The INRB is based at Avenue de la Démocratie (formerly Avenue des Huileries), BP 1197, Kinshasa-Gombe, DRC.
=== Philanthropy === In 1998, DiCaprio and his mother donated $35,000 for a "Leonardo DiCaprio Computer Center" at a library in Los Feliz. In May 2009, DiCaprio joined Kate Winslet, director James Cameron and Canadian singer Celine Dion, in a campaign to raise money to financially support the fees of the nursing home where Millvina Dean, a survivor of the RMS Titanic, was residing. DiCaprio and Winslet donated $20,000 to support Dean. In 2010, he donated $1 million to relief efforts in Haiti after the earthquake. In 2011, DiCaprio joined the Animal Legal Defense Fund's campaign to release Tony, a tiger that had spent the last decade at a truck stop in Grosse Tête, Louisiana. DiCaprio donated $61,000 to the gay rights group GLAAD in 2013. In 2016, DiCaprio donated $65,000 to the annual fundraising gala for the Children of Armenia Fund, where he was a special guest of his friend and honorary chair, Tony Shafrazi. Supporting Hurricane Harvey (2017) relief efforts, DiCaprio provided $1 million through his foundation. In 2020, DiCaprio's foundation donated $3 million to Australia bushfire relief efforts. Amidst the 2022 Russian invasion of Ukraine, the media announced DiCaprio donated $10 million to support Ukraine, although the news agency Associated Press suggested this amount was inaccurate.
== Specialty facilities == East Carolina Endoscopy Center East Carolina Heart Institute James & Connie Maynard Children's Hospital at ECU Health Medical Center Marion L. Shepard Cancer Center Onslow Radiation Oncology Service League of Greenville Inpatient Hospice ECU Health Behavioral Crisis Center ECU Health Cancer Care at the Eddie and Jo Allison Smith Tower in Greenville ECU Health Cardiovascular & Pulmonary Rehabilitation ECU Health Health Foundation ECU Health Home Health & Hospice ECU Health Medical Group Practices ECU Health Minor Emergency ECU Health Outpatient Rehabilitation ECU Health Pain Management Centers ECU Health Radiation Oncology ECU Health Sleep Centers ECU Health SurgiCenter ECU Health Wellness Centers ECU Health Wound Healing Centers
==== Malaysia ==== In March 2020, the Malaysian government temporarily banned the operation of all traditional markets (including pasar malam and pasar pagi) as a national response to the coronavirus pandemic.
=== For vaccine creation === SeV has several features that are important in a vector for a successful vaccine: the virus does not integrate into the host genome, it does not undergo genetic recombination, it replicates only in the cytoplasm without DNA intermediates or a nuclear phase. SeV, as all other representatives of family Paramyxoviridae, is genetically stable and evolves very slowly. SeV genome can accommodate foreign genes in multiple intergenic positions and the SeV genome is suitable for introducing genes encoding the envelope glycoproteins of pathogenic viruses. For vaccination purpose the virus-based constructs could be delivered in a form of nasal drops, which may be beneficial in inducing a mucosal immune response. This form of vaccination is more immunogenic than intramuscular considering pre-existing anti-SeV antibodies. Sendai virus-based constructs can induce durable, mucosal, B-cell, and T-cell immune responses. The virus genome has high similarity with human parainfluenza virus 1 (HPIV-1) and the two viruses share common antigenic determinants. The study that was published in 2011 demonstrated that SeV neutralizing antibodies (which were formed due to human parainfluenza virus type 1 past infection) can be detected in 92.5% of human subjects worldwide with a median EC50 titer of 60.6 and values ranging from 5.9–11,324. Low anti-SeV antibodies background does not block the ability of SeV-base vaccine to promote antigen-specific T cell immunity.
Sources: en.wikipedia.org
Low-grade chronic inflammation is characterized by a two- to threefold increase in the systemic concentrations of cytokines such as TNF-α, IL-6, and CRP. Waist circumference correlates significantly with systemic inflammatory response. Loss of white adipose tissue reduces levels of inflammation markers. As of 2017 the association of systemic inflammation with insulin resistance and type 2 diabetes, and with atherosclerosis was under preliminary research, although rigorous clinical trials had not been conducted to confirm such relationships. C-reactive protein (CRP) is generated at a higher level in obese people, and may increase the risk for cardiovascular diseases.
The two substrates of this enzyme are D-sorbitol 6-phosphate and oxidised nicotinamide adenine dinucleotide (NAD+). Its products are fructose 6-phosphate (shown in its open-chain form), reduced NADH, and a proton. This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. The systematic name of this enzyme class is D-sorbitol-6-phosphate:NAD+ 2-oxidoreductase. Other names in common use include ketosephosphate reductase, ketosephosphate reductase, D-sorbitol 6-phosphate dehydrogenase, D-sorbitol-6-phosphate dehydrogenase, sorbitol-6-P-dehydrogenase, and D-glucitol-6-phosphate dehydrogenase. This enzyme participates in fructose and mannose metabolism.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
==== Empirical correlations ==== Empirical correlations are simple mathematical expressions intended to approximate a liquid's properties over a range of experimental conditions, such as varying temperature and pressure. They are constructed by fitting simple functional forms to experimental data. For example, the temperature-dependence of liquid viscosity is sometimes approximated by the function
Sources: en.wikipedia.org
==== Gravimetric analysis ==== Gravimetric analysis involves determining the amount of material present by weighing the sample before and/or after some transformation. A common example used in undergraduate education is the determination of the amount of water in a hydrate by heating the sample to remove the water such that the difference in weight is due to the loss of water.
== Other investments == In 2019, 777 Partners bought the London Lions, London's sole men's professional basketball team. They then invested £7 million for 45% of the British Basketball League (BBL). 777 sold a slight minority stake in the London Lions to O.G. Anunoby and became the first British team to ever qualify for EuroCup playoffs. In May 2024, British Basketball revoked the license of the operating company behind the BBL, due to concerns over its financing. The BBL folded and was replaced by Super League Basketball. In August 2024, administrators Hudson Weir allowed the London Lions to be sold to Tesonet, the creators of NordVPN and owners of Lithuanian team BC Žalgiris. The new owners defended their decision to keep Lenz Balan, former vice president of 777 Partners, as CEO of the Lions. In 2022, 777 invested in STX Entertainment, a global film studio known for producing films such as Molly's Game, The Irishman, and Ferrari.
Many women in the lower levels of major drug cartels belong to a low economic class. Drug trafficking offers women an accessible way to earn income. Females from all social classes have become involved in the trade due to outside pressure from their social and economic environments.
Sources: en.wikipedia.org
Bremelanotide binds several melanocortin receptors, and MC4R is the subtype most often cited as responsible for its behavioural effects. Activity at MC1R, MC3R and MC5R is also reported. Selectivity is therefore described as limited rather than precise.
It is not classified as a vasodilator, and its proposed site of action is the central nervous system rather than peripheral vessels. Some trial participants show small transient blood pressure changes. Whether those changes arise centrally or through another route remains an open question.
Most evidence comes from animal models and from indirect human outcomes such as self-reported desire. Direct measurements of receptor occupancy or signalling in the human brain are not available. Published reviews therefore present a plausible pathway rather than a confirmed sequence of events.
It primarily activates specific subtypes in the melanocortin receptor family. These receptors are G protein-coupled and mediate signaling mainly within the central nervous system.