Everything below concerns certificate of analysis. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-05-20. Where a claim depends on a specific study, the study is described rather than over-claimed.
Lyophilized peptide material is generally stored at -20 °C or below to limit degradation, while reconstituted solutions are less stable and are typically kept refrigerated and protected from light. Repeated freeze-thaw cycles can accelerate aggregation and should be minimized. Stability for any specific lot depends on purity, moisture content, and packaging. Handling in a temperature-controlled environment reduces variability across replicates, and exposure to ambient humidity during weighing can introduce error. Aliquotting reduces the number of times a stock container is opened.
Reverse-phase high-performance liquid chromatography is the standard method for assessing purity. Mass spectrometry confirms molecular identity and detects sequence variants or truncation products. Ultraviolet absorbance at 214 or 280 nm is used for quantification, with the choice depending on the peptide sequence. Method validation typically addresses linearity, limit of detection, and precision across a defined concentration range. Impurity profiling may also employ ion-exchange or size-exclusion chromatography, and these techniques complement one another.
The compound emerged from a research programme examining melanocortin analogues for effects on skin pigmentation. During early human studies, participants reported spontaneous erections as an unexpected side effect, which redirected development toward sexual function rather than tanning. An intranasal formulation was investigated in clinical trials but did not reach market approval. A subcutaneous injectable version later completed the regulatory process, and the nasal route does not appear in approved labelling.
Approved use is narrow and jurisdiction-specific. In the United States, the injectable product is authorised for premenopausal women with acquired, generalised hypoactive sexual desire disorder, a diagnosis that requires documented distress. It is not approved for men, for postmenopausal women, or for use alongside hormonal contraceptives under the approved labelling. Outside regulated markets, the same peptide is frequently sold as a research chemical, where identity, purity, and sterility are not independently verified.
| Property | Value | Notes |
|---|---|---|
| Storage form | Lyophilized powder | Longer stability at -20 °C |
| Reconstitution solvent | Sterile water or buffer | Depends on intended application |
| Purity assessment | Reverse-phase HPLC | Reported as peak area percentage |
| Identity confirmation | Mass spectrometry | Compared against theoretical mass |
| Main stability concern | Repeated freeze-thaw | May promote aggregation |
Whether the behavioral effect originates centrally, peripherally, or through both remains an active question. Animal experiments using receptor antagonists and site-specific injections point toward hypothalamic melanocortin circuits as a key locus, but translating those findings to humans is not straightforward. Blood pressure changes observed in trials suggest a vascular component that may be peripherally mediated. The relationship between receptor occupancy and reported effect has not been mapped in humans, and no validated biomarker predicts response. This gap makes it difficult to explain individual variability on pharmacological grounds alone.
Bremelanotide acts as an agonist at melanocortin receptors, a family of five G-protein-coupled receptors labeled MC1 through MC5. Binding studies indicate activity at several of these subtypes rather than strict selectivity for one. Signalling proceeds mainly through Gs-mediated activation of adenylyl cyclase, raising intracellular cyclic AMP. The MC4 receptor, expressed in hypothalamic and limbic circuits, is widely regarded as the subtype most relevant to sexual response. Because the molecule is not subtype-selective, effects at other melanocortin receptors are expected and are used to explain some observed side effects.
The peptide contains seven amino acids arranged in a ring, closed by a lactam bridge between a side-chain acid and an amine. This cyclic constraint holds the backbone in a defined conformation and increases resistance to enzymatic breakdown relative to linear analogs. N-terminal acetylation and a C-terminal amide further protect the molecule from exopeptidases. The result is a compound with a comparatively long circulation time for a small peptide. Structural modification of the bridge alters receptor affinity, which is one reason analogs in this family differ in their subtype preferences.
Compared with melanotan II, bremelanotide is a smaller cyclic peptide with a more constrained backbone, which affects receptor selectivity and metabolic stability. Published descriptions give a plasma half-life on the order of a few hours after subcutaneous administration, with elimination through hepatic and renal routes and limited plasma protein binding. Central access is inferred from effects observed in animal models, although direct measurement in humans is limited. Handling and storage requirements follow from the peptide backbone, which is susceptible to hydrolysis and oxidation.
The melanocortin system comprises five G protein-coupled receptors, designated MC1 through MC5, that signal mainly through cyclic AMP accumulation. MC1R and MC2R are associated with pigmentation and adrenal steroid production, while MC3R and MC4R are expressed in the central nervous system and influence energy balance and behavior. MC5R appears in exocrine tissues. Natural agonists include alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone, and endogenous antagonists such as agouti-related protein modulate the same sites. This receptor family provides the framework within which bremelanotide activity is described.
Pyocyanin inactivates catalase by reducing its gene’s transcription as well as directly targeting the enzyme itself. Glutathione is an important antioxidant modulated by pyocyanin. In particular the pool of the reduced form is depleted while the oxidised form is promoted by hydrogen peroxide which is not dismutated by catalase. In the cystic fibrosis lung, intracellular pyocyanin converts molecular oxygen to the superoxide free radical by oxidizing NADPH to NADP+. This has a doubly negative effect on the lungs. Firstly, the NADPH used by pyocyanin depletes the available substrate for the reaction catalysed by the NADPH oxidase enzyme. Secondly, the superoxide radical generated can inhibit cytokines, such as IL-4, IL-13 and IFN-γ, which usually upregulate NADPH oxidase. When the lung is confronted with pyocyanin, an increased concentration of catalase and superoxide dismutase is seen in order to deal with the barrage of radicals being produced.
At the present time the Department promotes various scientific fields, running the whole gamut of base branches of classical physical chemistry: thermodynamics, kinetics, electrochemistry, catalysis, sorption processes. As the subjects of research, organic compounds unite all the aforesaid research areas. Over the last years staff members of the Department of Physical Chemistry made reports at conferences in many countries of the world: Canada, Poland, Republic of South Africa, Italy, Germany, Portugal, Czech Republic, USA, Ireland, Croatia, Spain, Sweden, Japan, Brazil. The head of the Department is Professor Boris N. Solomonov, Doctor of Science in Chemistry. The Department conducts research in the following fields:
HA (aq) + H2O (l) ⇌ H3O+ (aq) + A− (aq) Ka Common examples of monoprotic acids in mineral acids include hydrochloric acid (HCl) and nitric acid (HNO3). On the other hand, for organic acids the term mainly indicates the presence of one carboxylic acid group and sometimes these acids are known as monocarboxylic acid. Examples in organic acids include formic acid (HCOOH), acetic acid (CH3COOH) and benzoic acid (C6H5COOH). Polyprotic acids, also known as polybasic acids, are able to donate more than one proton per acid molecule, in contrast to monoprotic acids that only donate one proton per molecule. Specific types of polyprotic acids have more specific names, such as diprotic (or dibasic) acid (two potential protons to donate), and triprotic (or tribasic) acid (three potential protons to donate). Some macromolecules such as proteins and nucleic acids can have a very large number of acidic protons. A diprotic acid (here symbolized by H2A) can undergo one or two dissociations depending on the pH. Each dissociation has its own dissociation constant, Ka1 and Ka2.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Blood or urine tests measure hCG. These can be pregnancy tests. hCG-positive can indicate an implanted blastocyst and mammalian embryogenesis or can be detected for a short time following childbirth or pregnancy loss. Tests can be done to diagnose and monitor germ cell tumors and gestational trophoblastic diseases. Concentrations are commonly reported in thousandth international units per milliliter (mIU/mL). The international unit of hCG was originally established in 1938 and has been redefined in 1964 and in 1980. At the present time, 1 international unit is equal to approximately 2.35×10−12 moles, or about 6×10−8 grams. It is also possible to test for hCG to have an approximation of the gestational age.
The manifestation of apical dominance differs significantly between plant groups due to the positioning of their growing points (meristems): Broadleaf plants: The apical meristem is located at the shoot tip, elevated above the ground. Apical dominance is exerted downward, inhibiting axillary buds along the stem. Removing the apex (pruning) releases these buds, resulting in lateral branching and a bushier shape. Grasses: During vegetative growth, the primary apical meristem remains at or near the soil surface in a region called the crown. Growth occurs via intercalary meristems at the base of the leaves. Apical dominance in grasses primarily regulates tillering—the production of new shoots from basal buds. Because the meristem is protected at ground level, grasses can be mown or grazed without destroying the primary growing point, allowing them to recover more quickly than most broadleaf species. Plant physiologists have identified four different stages the plant goes through after the apex is removed (Stages I-IV). The four stages are referred to as:
First observations of short-lived pear-shaped atomic nuclei Research conducting using the Miniball experimental setup found evidence of pear-shaped heavy nuclei, in particular radon-220 and radium-224. These results were named in the Institute of Physics (IoP) "top 10 breakthroughs in physics" in 2013, and was featured as the cover of Nature 2013. In 2020, due to the HIE-ISOLDE upgrade, radium-222 was also found to have a "stable pear shape". Laser spectroscopy has been performed on a short-lived radioactive molecule, containing radium, which further studies into could reveal physics beyond the Standard Model due to time-reversal symmetry breaking. Measurement of 229mTh transition energy In 2023, ISOLDE made the first 1%-level measurement of the ultralow-energy thorium-229m nuclear isomer, detecting photons at an energy of 8.338±0.024 eV. This was a key step in the construction of a future nuclear clock. Below is a list of improvements needed for the ISOLDE facility, considering both medium and long-term goals. Some of these improvements have been proposed by the EPIC project.
A synchronous or synchronized culture is a microbiological culture or a cell culture that contains cells that are all in the same growth stage. As numerous factors influence the cell cycle (some of them stochastic) normal cultures have cells in all stages of the cell cycle. Obtaining a culture with a unified cell-cycle stage is useful for biological research where a particular stage in the cell cycle is desired (such as the culturing of parasitized cells). Since cells are too small for certain research techniques, a synchronous culture can be treated as a single cell; the number of cells in the culture can be easily estimated, and quantitative experimental results can simply be divided in the number of cells to obtain values that apply to a single cell. Synchronous cultures have been extensively used to address questions regarding cell cycle and growth, and the effects of various factors on these. Synchronous cultures can be obtained in several ways:
ACS first established technical divisions in 1908 to foster the exchange of information among scientists who work in particular fields of chemistry or professional interests. Divisional activities include organizing technical sessions at ACS meetings, publishing books and resources, administering awards and lectureships, and conducting other events. The original five divisions were 1) organic chemistry, 2) industrial chemists and chemical engineers, 3) agricultural and food chemistry, 4) fertilizer chemistry, and 5) physical and inorganic chemistry. As of 2016, there are 32 technical divisions of ACS.
Sources: en.wikipedia.org
In order for a protonated acid to lose a proton, the pH of the system must rise above the pKa of the acid. The decreased concentration of H+ in that basic solution shifts the equilibrium towards the conjugate base form (the deprotonated form of the acid). In lower-pH (more acidic) solutions, there is a high enough H+ concentration in the solution to cause the acid to remain in its protonated form. Solutions of weak acids and salts of their conjugate bases form buffer solutions. To determine the concentration of an acid in an aqueous solution, an acid–base titration is commonly performed. A strong base solution with a known concentration, usually NaOH or KOH, is added to neutralize the acid solution according to the color change of the indicator with the amount of base added. The titration curve of an acid titrated by a base has two axes, with the base volume on the x-axis and the solution's pH value on the y-axis. The pH of the solution always goes up as the base is added to the solution.
The method numbers generally range from 1 to 9000 and may have modification letters appended to the end, signifying a newer version of the method has been released. Some ranges of numbers appear to be organized with intention, for example methods 1-99 being air methods or the 7000s being for hazardous waste. Others number ranges, however, seem to only contain random methods, like the 300 and 400 series both being for wet chemistry methods. EPA methods are listed by category on the EPA website. The US government keeps a collection of environmental testing methods at the National Environmental Methods Index website which includes EPA methods along with methods from other agencies like the USGS. Analytical chemistry EPA Hazardous Waste Test Methods EPA Air Emission Methods with Links Clean Water Act Analytical Methods Drinking Water Analytical Methods
A. Hari Reddi (born October 20, 1942) is a University of California Distinguished Professor and inaugural holder of the Lawrence J. Ellison Endowed Chair in Musculoskeletal Molecular Biology at the University of California, Davis. His research played an indispensable role in the identification, isolation and purification of bone morphogenetic proteins (BMPs) that are involved in bone formation and repair. The molecular mechanism of bone induction studied by Professor Reddi led to the conceptual advance in tissue engineering that morphogens in the form of metabologens bound to an insoluble extracellular matrix scaffolding act in collaboration to stimulate stem cells to form cartilage and bone. The Reddi laboratory has also made important discoveries unraveling the role of the extracellular matrix in bone and cartilage tissue regeneration and repair. Professor Reddi was previously the Virginia M. and William A. Percy Chair and Professor in Orthopaedic Surgery, Professor of Biological Chemistry, and Professor of Oncology at the Johns Hopkins University School of Medicine. He was also a past faculty member at the University of Chicago and senior scientist at the National Institutes of Health.
11-Deoxycortisol in mammals has limited biological activity and mainly acts as metabolic intermediate within the glucocorticoid pathway, leading to cortisol. However, in sea lampreys, an early jawless fish species that originated over 500 million years ago, 11-deoxycortisol is the primary and ultimate glucocorticoid hormone with mineralocorticoid properties; 11-deoxycortisol also takes part, by binding to specific corticosteroid receptors, in intestinal osmoregulation in sea lamprey at metamorphosis, during which they develop seawater tolerance before downstream migration. Sea lampreys do not possess the 11β-hydroxylase enzyme (CYP11B1) responsible for converting 11-deoxycortisol to cortisol and 11-deoxycorticosterone to corticosterone, as observed in mammals. The absence of this enzyme in sea lampreys indicates the existence of a complex and highly specific corticosteroid signaling pathway that emerged at least 500 million years ago with the advent of early vertebrates. The lack of cortisol and corticosterone in sea lampreys suggests that the presence of the 11β-hydroxylase enzyme may have been absent during the early stages of vertebrate evolution. The absence of cortisol and corticosterone in sea lampreys suggests that the 11β-hydroxylase enzyme may not have been present early in vertebrate evolution.
The Department of Mines and Petroleum was a department of the Government of Western Australia until it was superseded by the Department of Mines, Industry Regulation & Safety on 1 July 2017. The department was formed on 1 January 2009, out of the former Department of Industry & Resources and Department of Consumer & Employment Protection, which were split into three new departments, the Department of Mines & Petroleum, the Department of State Development and the Department of Commerce. Its focus is the resources sector, maintaining a mining and petroleum regulatory role and incorporating the resources safety responsibilities from the former Department of Consumer & Employment Protection. It also oversees the Geological Survey of Western Australia. The department operates the Mindex website, a continuously updated database containing information on mines, mineral deposits and prospects in Western Australia.
Sources: en.wikipedia.org
Storage at -20 °C or below is standard for long-term stability. Desiccant and sealed containers limit moisture exposure. Solutions are prepared only when needed.
Reverse-phase HPLC separates components by hydrophobicity and reports purity as a percentage of total peak area. It does not by itself confirm molecular identity. Mass spectrometry is used alongside it for that purpose.
They link a specific lot to its analytical results and storage history. This traceability supports reproducibility when results differ between experiments. Records also help identify when re-testing is warranted.
It is a synthetic cyclic peptide that acts as an agonist at melanocortin receptors. It is not a hormone replacement therapy and not a vasodilator in the usual clinical sense, although it does affect vascular tone. Chemically it belongs to the melanocortin analogue family.